2 Union Square, Union City, CA 94587
contact@NeoBiotechnologies.com
510-376-5603

Home >> Antibodies >> DOG-1 / ANO1 (Marker for Gastrointestinal Stromal Tumors)

DOG-1 / ANO1 (Marker for Gastrointestinal Stromal Tumors)

Mouse Monoclonal Antibody [Clone DG1/447 + DOG-1.1]

Catalog #

Size

20 ug
100 ug
100 ug

Price (USD)

219.00
499.00
499.00

Formulation

Purified Ab with BSA and Azide at 200ug/ml
Purified Ab with BSA and Azide at 200ug/ml
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml

Catalog No

Size

20 ug
100 ug
100 ug

Formulation

Purified Ab with BSA and Azide at 200ug/ml
Purified Ab with BSA and Azide at 200ug/ml
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml

Price (USD)

219.00
499.00
499.00
img

Formalin-fixed, paraffin-embedded human GIST stained with DOG-1 Monoclonal Antibody (DG1/447 + DOG1.1).

Product Details

Synonyms

Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A

Positive Control

Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.

Known Applications & Suggested Dilutions

IHC-P         More Details

Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined.

Immunogen

Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).

Cellular Localization

Cell Surface and Cytoplasm

Species Reactivity

Human.

Host / Ig Isotype

Mouse / IgG1, kappa + Mouse / IgG1, kappa

Mol. Weight of Antigen

~114kDa

Specificity & Comments

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST's), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST's, including all c-kit negative GIST's. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST's is nearly identical: 94.4% vs. 94.7%.

Related Products



200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Key References

  1. Espinosa I, et. al. Am J Surg Pathol 2008;32:210-218.

Bioinformatics

  •  Entrez Gene ID: 55107
  •  Gene Symbol: TMEM16A
  •  SwissProt: Q5XX6
  •  Chromosome Location: 11q13.3
  •  Unigene: 503074
NBT00726